![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
![]() | Protein automated matches [191142] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) |
![]() | Domain d5k74b_: 5k74 B: [334834] automated match to d3l0la_ complexed with 6qw |
PDB Entry: 5k74 (more details), 2.75 Å
SCOPe Domain Sequences for d5k74b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k74b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhp
Timeline for d5k74b_: