Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Enterovirus a71 [TaxId:39054] [313489] (6 PDB entries) |
Domain d5gsoe_: 5gso E: [334822] automated match to d2vb0a_ complexed with 5gi |
PDB Entry: 5gso (more details), 2.6 Å
SCOPe Domain Sequences for d5gsoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gsoe_ b.47.1.0 (E:) automated matches {Enterovirus a71 [TaxId: 39054]} gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldav elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv qygflnlsgkpthrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrsyfa s
Timeline for d5gsoe_:
View in 3D Domains from other chains: (mouse over for more information) d5gsoa_, d5gsob_, d5gsoc_, d5gsod_ |