SCOPe 2.08: Domain d5vmqc2: 5vmq C:151-309

Lineage for d5vmqc2 (5vmq C:151-309)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:585035] [334795] (1 PDB entry)

8. Domain d5vmqc2: 5vmq C:151-309 [334812]
   automated match to d1i5oa2
   complexed with ca, cl; mutant

Details for d5vmqc2

PDB Entry: 5vmq, 2.01 Å

PDB Description: structure of the r105a mutant catalytic trimer of escherichia coli aspartate transcarbamoylase at 2.0-a resolution

PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d5vmqc2:

Sequence; same for both SEQRES and ATOM records:

>d5vmqc2 c.78.1.1 (C:151-309) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 585035]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlv

Timeline for d5vmqc2:

• d5vmqc2 first appeared in SCOPe 2.06
  
• d5vmqc2 appears in SCOPe 2.07