| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
| Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
| Species Escherichia coli [TaxId:585035] [334795] (1 PDB entry) |
| Domain d5vmqc1: 5vmq C:1-150 [334811] automated match to d1i5oa1 complexed with ca, cl; mutant |
PDB Entry: 5vmq (more details), 2.01 Å
SCOPe Domain Sequences for d5vmqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vmqc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 585035]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmahpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d5vmqc1:
View in 3DDomains from other chains: (mouse over for more information) d5vmqa1, d5vmqa2, d5vmqb1, d5vmqb2 |