SCOPe 2.07: Domain d5vjkb_: 5vjk B:

Lineage for d5vjkb_ (5vjk B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus [TaxId:1332244] [327811] (5 PDB entries)

8. Domain d5vjkb_: 5vjk B: [334803]
   Other proteins in same PDB: d5vjka_
   automated match to d4kdmb_
   complexed with bma, nag; mutant

Details for d5vjkb_

PDB Entry: 5vjk, 2.59 Å

PDB Description: crystal structure of h7 hemagglutinin mutant (v186k, k193t, g228s) from the influenza virus a/shanghai/2/2013 (h7n9)

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5vjkb_:

Sequence; same for both SEQRES and ATOM records:

>d5vjkb_ h.3.1.0 (B:) automated matches {Influenza A virus [TaxId: 1332244]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamq

Timeline for d5vjkb_:

• d5vjkb_ first appeared in SCOPe 2.06
  
• d5vjkb_ appears in the current release, SCOPe 2.08