SCOPe 2.08: Domain d5usfd1: 5usf D:6-117

Lineage for d5usfd1 (5usf D:6-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5usfd1: 5usf D:6-117 [334791]
   Other proteins in same PDB: d5usfc2, d5usfc3, d5usfd2, d5usfd3
   automated match to d4bfbe_
   protein/RNA complex; complexed with ysa

Details for d5usfd1

PDB Entry: 5usf, 2.75 Å

PDB Description: leishmania donovani tyrosyl-trna synthetase in complex with nanobody and inhibitor

PDB Compounds: (D:) immunoglobulin heavy chain variable region

SCOPe Domain Sequences for d5usfd1:

Sequence; same for both SEQRES and ATOM records:

>d5usfd1 b.1.1.1 (D:6-117) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvlpggslrlscatsgftfsnswmywvrqapgkglewvsrinaggntvdykdsvk
grfsisrdnakntlylqmnslkpedtavyycarglnryaydsrgqgtqvtvs

Timeline for d5usfd1:

• d5usfd1 first appeared in SCOPe 2.06, called d5usfd_
  
• d5usfd1 appears in SCOPe 2.07