SCOPe 2.08: Domain d5uewb1: 5uew B:347-454

Lineage for d5uewb1 (5uew B:347-454)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5uewb1: 5uew B:347-454 [334788]
   Other proteins in same PDB: d5uewa2, d5uewb2
   automated match to d4qeua_
   complexed with 87d

Details for d5uewb1

PDB Entry: 5uew, 1.83 Å

PDB Description: brd2 bromodomain2 with a-1360579

PDB Compounds: (B:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d5uewb1:

Sequence; same for both SEQRES and ATOM records:

>d5uewb1 a.29.2.0 (B:347-454) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmenr
dyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp

Timeline for d5uewb1:

• d5uewb1 first appeared in SCOPe 2.06
  
• d5uewb1 appears in SCOPe 2.07