Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
Protein Mammalian purple acid phosphatase [56304] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [56306] (2 PDB entries) |
Domain d5uq6a_: 5uq6 A: [334783] automated match to d1utea_ complexed with fe, na, nag, oh, po4 |
PDB Entry: 5uq6 (more details), 1.18 Å
SCOPe Domain Sequences for d5uq6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uq6a_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} tpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvhdak dkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrfk iprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedyvlv aghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsgagn fmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktklprr a
Timeline for d5uq6a_: