Lineage for d5uq6a_ (5uq6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998038Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 2998039Protein Mammalian purple acid phosphatase [56304] (2 species)
  7. 2998043Species Pig (Sus scrofa) [TaxId:9823] [56306] (2 PDB entries)
  8. 2998044Domain d5uq6a_: 5uq6 A: [334783]
    automated match to d1utea_
    complexed with fe, na, nag, oh, po4

Details for d5uq6a_

PDB Entry: 5uq6 (more details), 1.18 Å

PDB Description: pig purple acid phosphatase complexed with phosphate in two coordination modes along with a bridging hydroxide ion
PDB Compounds: (A:) tartrate-resistant acid phosphatase type 5

SCOPe Domain Sequences for d5uq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uq6a_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]}
tpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvhdak
dkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrfk
iprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedyvlv
aghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsgagn
fmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktklprr
a

SCOPe Domain Coordinates for d5uq6a_:

Click to download the PDB-style file with coordinates for d5uq6a_.
(The format of our PDB-style files is described here.)

Timeline for d5uq6a_: