Lineage for d5vsvc_ (5vsv C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415584Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2415631Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2415632Protein automated matches [227084] (14 species)
    not a true protein
  7. 2415752Species Clostridium perfringens [TaxId:195103] [258287] (8 PDB entries)
  8. 2415766Domain d5vsvc_: 5vsv C: [334772]
    automated match to d4q33a_
    complexed with 8ky, imp

Details for d5vsvc_

PDB Entry: 5vsv (more details), 2.21 Å

PDB Description: crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and p225
PDB Compounds: (C:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5vsvc_:

Sequence, based on SEQRES records: (download)

>d5vsvc_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]}
rilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiama
reggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivld
tahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsicttr
ivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagce
eapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykghladt
iyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5vsvc_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]}
rilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiama
reggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivld
tahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsicttr
ivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagce
eapgaieiyqgrsykvyrgmgslgamakkfvpegvegriaykghladtiyqliggiksgm
gylgaptlenlyenanfvvqtsagfreshphdinitkeapnys

SCOPe Domain Coordinates for d5vsvc_:

Click to download the PDB-style file with coordinates for d5vsvc_.
(The format of our PDB-style files is described here.)

Timeline for d5vsvc_: