Lineage for d1hkca3 (1hkc A:466-670)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701578Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 701592Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 701593Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)
  8. 701608Domain d1hkca3: 1hkc A:466-670 [33477]

Details for d1hkca3

PDB Entry: 1hkc (more details), 2.8 Å

PDB Description: recombinant human hexokinase type i complexed with glucose and phosphate
PDB Compounds: (A:) d-glucose 6-phosphotransferase

SCOP Domain Sequences for d1hkca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkca3 c.55.1.3 (A:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
qhrqieetlahfhltkdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgten
gdflaldlggtnfrvllvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdf
ldymgikgprmplgftfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrre
efdldvvavvndtvgtmmtcayeep

SCOP Domain Coordinates for d1hkca3:

Click to download the PDB-style file with coordinates for d1hkca3.
(The format of our PDB-style files is described here.)

Timeline for d1hkca3: