Lineage for d5vmkc1 (5vmk C:2-248)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899289Species Acinetobacter baumannii [TaxId:470] [334701] (1 PDB entry)
  8. 2899292Domain d5vmkc1: 5vmk C:2-248 [334768]
    Other proteins in same PDB: d5vmka2, d5vmkb2, d5vmkc2
    automated match to d3fwwa1
    complexed with cit, pg4, po4

Details for d5vmkc1

PDB Entry: 5vmk (more details), 2.55 Å

PDB Description: crystal structure of a bifunctional glmu udp-n-acetylglucosamine diphosphorylase/glucosamine-1- phosphate n-acetyltransferase from acinetobacter baumannii
PDB Compounds: (C:) Bifunctional protein glmU

SCOPe Domain Sequences for d5vmkc1:

Sequence, based on SEQRES records: (download)

>d5vmkc1 c.68.1.0 (C:2-248) automated matches {Acinetobacter baumannii [TaxId: 470]}
sttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiyghggdhvkk
tfaqeniqwveqaeqlgtghavqmtlpvlpkdgislilygdvplvrqttleqlievsnkt
gigmitlhvdnptgygrivrqdgkiqaivehkdateaqrqiqeintgiycvsnaklhewl
pklsnenaqgeyyltdivamavadgleiasiqpelafevegvndrlqlaalerefqkqqa
kelmqqg

Sequence, based on observed residues (ATOM records): (download)

>d5vmkc1 c.68.1.0 (C:2-248) automated matches {Acinetobacter baumannii [TaxId: 470]}
sttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiyghggdhvkk
tfaqeniqwveqagtghavqmtlpislilygdvplvrqttleqlievsnktgigmitlhv
dnptgygrikiqaivehkdateaqrqiqeintgiycvsnaklhewlpklsmavadiasiq
pelafevegvndrlqlaalerefqkqqakelmqqg

SCOPe Domain Coordinates for d5vmkc1:

Click to download the PDB-style file with coordinates for d5vmkc1.
(The format of our PDB-style files is described here.)

Timeline for d5vmkc1: