![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48940] (9 PDB entries) |
![]() | Domain d5truc_: 5tru C: [334767] Other proteins in same PDB: d5truh_, d5trul1, d5trul2 automated match to d2x44d_ |
PDB Entry: 5tru (more details), 3 Å
SCOPe Domain Sequences for d5truc_:
Sequence, based on SEQRES records: (download)
>d5truc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} amhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgnelt flddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvi
>d5truc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} amhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgnelt fdsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvi
Timeline for d5truc_: