Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins) |
Protein automated matches [226957] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225382] (4 PDB entries) |
Domain d5nbfa_: 5nbf A: [334756] automated match to d2iyba_ complexed with 8s8, no3, so4 |
PDB Entry: 5nbf (more details), 1.15 Å
SCOPe Domain Sequences for d5nbfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nbfa_ b.55.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl
Timeline for d5nbfa_: