![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein Phycocyanin beta subunit [88940] (9 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [189583] (12 PDB entries) |
![]() | Domain d5uvkb_: 5uvk B: [334755] Other proteins in same PDB: d5uvka_ automated match to d1jbob_ complexed with cyc |
PDB Entry: 5uvk (more details), 3.1 Å
SCOPe Domain Sequences for d5uvkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uvkb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]} mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
Timeline for d5uvkb_: