SCOPe 2.08: Domain d5uvkb_: 5uvk B:

Lineage for d5uvkb_ (5uvk B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (9 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [189583] (12 PDB entries)

8. Domain d5uvkb_: 5uvk B: [334755]
   Other proteins in same PDB: d5uvka_
   automated match to d1jbob_
   complexed with cyc

Details for d5uvkb_

PDB Entry: 5uvk, 3.1 Å

PDB Description: serial millisecond crystallography of membrane and soluble protein micro-crystals using synchrotron radiation

PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d5uvkb_:

Sequence; same for both SEQRES and ATOM records:

>d5uvkb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d5uvkb_:

• d5uvkb_ first appeared in SCOPe 2.06
  
• d5uvkb_ appears in SCOPe 2.07