Lineage for d5vpsa1 (5vps A:1-259)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2430742Species Burkholderia ambifaria [TaxId:398577] [334735] (1 PDB entry)
  8. 2430743Domain d5vpsa1: 5vps A:1-259 [334736]
    Other proteins in same PDB: d5vpsa2
    automated match to d5idxb_
    complexed with 9g1, edo

Details for d5vpsa1

PDB Entry: 5vps (more details), 1.45 Å

PDB Description: crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d5vpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vpsa1 c.2.1.0 (A:1-259) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mdlgiagktalvcaaskglgrgcaealaaegvnlvivartrdtleetaeeiraasnvsvt
avacdittpdgraaalaacpqpdilvnnaggpppgdfrdfshddwiraleanmltpieli
ratvdgmigrgfgrivnitssavkapidvlalsngarsgltgfvaglsrkvagqgvtinn
llpglfdtdriattlaasakaqgvtvdelrarrakeipagrlgtraefgaacaflcsvha
gyitgqnwlldggaypgtf

SCOPe Domain Coordinates for d5vpsa1:

Click to download the PDB-style file with coordinates for d5vpsa1.
(The format of our PDB-style files is described here.)

Timeline for d5vpsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vpsa2