![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries) |
![]() | Domain d5vjla_: 5vjl A: [334734] Other proteins in same PDB: d5vjlb_ automated match to d4d00c_ complexed with moh, nag, sia; mutant |
PDB Entry: 5vjl (more details), 2.6 Å
SCOPe Domain Sequences for d5vjla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vjla_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 1332244]} iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhskstaeq ttlygsgnklvtvgssnyqqsfvpspgarpqvnglssridfhwlmlnpndtvtfsfngaf iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq rslllatgmknvpe
Timeline for d5vjla_: