Lineage for d5vt6c_ (5vt6 C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2430819Species Burkholderia pseudomallei [TaxId:320372] [188646] (7 PDB entries)
  8. 2430828Domain d5vt6c_: 5vt6 C: [334726]
    automated match to d3uf0a_
    complexed with act, edo, imd, nap

Details for d5vt6c_

PDB Entry: 5vt6 (more details), 1.7 Å

PDB Description: crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with nadp
PDB Compounds: (C:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d5vt6c_:

Sequence, based on SEQRES records: (download)

>d5vt6c_ c.2.1.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
krvafvtggmgglgaaisrrlhdagmavavshserndhvstwlmherdagrdfkayavdv
adfescercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtkq
fiagmverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntvs
pgylatamveavpqdvleakilpqipvgrlgrpdevaaliaflcsddagfvtgadlaing
gmhms

Sequence, based on observed residues (ATOM records): (download)

>d5vt6c_ c.2.1.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
krvafvtggmgglgaaisrrlhdagmavavshserndhvstwlmherdagrdfkayavdv
adfescercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtkq
fiagmverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntvs
pgylatvpqdvleakilpqipvgrlgrpdevaaliaflcsddagfvtgadlainggmhms

SCOPe Domain Coordinates for d5vt6c_:

Click to download the PDB-style file with coordinates for d5vt6c_.
(The format of our PDB-style files is described here.)

Timeline for d5vt6c_: