SCOPe 2.06: Domain d5vmkb2: 5vmk B:249-449

Lineage for d5vmkb2 (5vmk B:249-449)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (30 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [193329] (4 PDB entries)

8. Domain d5vmkb2: 5vmk B:249-449 [334717]
   Other proteins in same PDB: d5vmka1, d5vmkb1, d5vmkc1
   automated match to d3fwwa2
   complexed with cit, pg4, po4

Details for d5vmkb2

PDB Entry: 5vmk, 2.55 Å

PDB Description: crystal structure of a bifunctional glmu udp-n-acetylglucosamine diphosphorylase/glucosamine-1- phosphate n-acetyltransferase from acinetobacter baumannii

PDB Compounds: (B:) Bifunctional protein glmU

SCOPe Domain Sequences for d5vmkb2:

Sequence; same for both SEQRES and ATOM records:

>d5vmkb2 b.81.1.0 (B:249-449) automated matches {Acinetobacter baumannii [TaxId: 470]}
vtfadparfdlrgtvkvghdvridvnviiegncelgdfveigagcilknttiaagtkvqa
ysvfdgavvgentqigpfarlrpgaklanevhignfvevknttiglgskanhftylgdae
igaesnigagtitcnydgankhkttigdavfigsnsslvapvtigngatvgagsvitkdv
aeqslsferaqqiskanyqrp

Timeline for d5vmkb2:

• d5vmkb2 is new in SCOPe 2.06-stable
  
• d5vmkb2 appears in SCOPe 2.07
  
• d5vmkb2 appears in the current release, SCOPe 2.08