Lineage for d5vmkb2 (5vmk B:249-449)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814182Species Acinetobacter baumannii [TaxId:470] [193329] (4 PDB entries)
  8. 2814194Domain d5vmkb2: 5vmk B:249-449 [334717]
    Other proteins in same PDB: d5vmka1, d5vmkb1, d5vmkc1
    automated match to d3fwwa2
    complexed with cit, pg4, po4

Details for d5vmkb2

PDB Entry: 5vmk (more details), 2.55 Å

PDB Description: crystal structure of a bifunctional glmu udp-n-acetylglucosamine diphosphorylase/glucosamine-1- phosphate n-acetyltransferase from acinetobacter baumannii
PDB Compounds: (B:) Bifunctional protein glmU

SCOPe Domain Sequences for d5vmkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmkb2 b.81.1.0 (B:249-449) automated matches {Acinetobacter baumannii [TaxId: 470]}
vtfadparfdlrgtvkvghdvridvnviiegncelgdfveigagcilknttiaagtkvqa
ysvfdgavvgentqigpfarlrpgaklanevhignfvevknttiglgskanhftylgdae
igaesnigagtitcnydgankhkttigdavfigsnsslvapvtigngatvgagsvitkdv
aeqslsferaqqiskanyqrp

SCOPe Domain Coordinates for d5vmkb2:

Click to download the PDB-style file with coordinates for d5vmkb2.
(The format of our PDB-style files is described here.)

Timeline for d5vmkb2: