| Class b: All beta proteins [48724] (180 folds) |
| Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
| Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
| Protein automated matches [190967] (36 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [193329] (4 PDB entries) |
| Domain d5vmkb2: 5vmk B:249-449 [334717] Other proteins in same PDB: d5vmka1, d5vmkb1, d5vmkc1 automated match to d3fwwa2 complexed with cit, pg4, po4 |
PDB Entry: 5vmk (more details), 2.55 Å
SCOPe Domain Sequences for d5vmkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vmkb2 b.81.1.0 (B:249-449) automated matches {Acinetobacter baumannii [TaxId: 470]}
vtfadparfdlrgtvkvghdvridvnviiegncelgdfveigagcilknttiaagtkvqa
ysvfdgavvgentqigpfarlrpgaklanevhignfvevknttiglgskanhftylgdae
igaesnigagtitcnydgankhkttigdavfigsnsslvapvtigngatvgagsvitkdv
aeqslsferaqqiskanyqrp
Timeline for d5vmkb2:
View in 3DDomains from other chains: (mouse over for more information) d5vmka1, d5vmka2, d5vmkc1, d5vmkc2 |