Lineage for d5vjlb_ (5vjl B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267795Species Influenza a virus [TaxId:1332244] [327811] (4 PDB entries)
  8. 2267803Domain d5vjlb_: 5vjl B: [334711]
    Other proteins in same PDB: d5vjla_
    automated match to d4kdmb_
    complexed with moh, nag, sia; mutant

Details for d5vjlb_

PDB Entry: 5vjl (more details), 2.6 Å

PDB Description: crystal structure of h7 hemagglutinin mutant (v186k, k193t, g228s) from the influenza virus a/shanghai/2/2013 (h7n9) with lstc
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5vjlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjlb_ h.3.1.0 (B:) automated matches {Influenza a virus [TaxId: 1332244]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamq

SCOPe Domain Coordinates for d5vjlb_:

Click to download the PDB-style file with coordinates for d5vjlb_.
(The format of our PDB-style files is described here.)

Timeline for d5vjlb_: