Lineage for d5vmka1 (5vmk A:2-248)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899289Species Acinetobacter baumannii [TaxId:470] [334701] (1 PDB entry)
  8. 2899290Domain d5vmka1: 5vmk A:2-248 [334702]
    Other proteins in same PDB: d5vmka2, d5vmkb2, d5vmkc2
    automated match to d3fwwa1
    complexed with cit, pg4, po4

Details for d5vmka1

PDB Entry: 5vmk (more details), 2.55 Å

PDB Description: crystal structure of a bifunctional glmu udp-n-acetylglucosamine diphosphorylase/glucosamine-1- phosphate n-acetyltransferase from acinetobacter baumannii
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d5vmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmka1 c.68.1.0 (A:2-248) automated matches {Acinetobacter baumannii [TaxId: 470]}
sttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiyghggdhvkk
tfaqeniqwveqaeqlgtghavqmtlpvlpkdgislilygdvplvrqttleqlievsnkt
gigmitlhvdnptgygrivrqdgkiqaivehkdateaqrqiqeintgiycvsnaklhewl
pklsnenaqgeyyltdivamavadgleiasiqpelafevegvndrlqlaalerefqkqqa
kelmqqg

SCOPe Domain Coordinates for d5vmka1:

Click to download the PDB-style file with coordinates for d5vmka1.
(The format of our PDB-style files is described here.)

Timeline for d5vmka1: