![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Trypanosoma brucei [TaxId:185431] [334698] (1 PDB entry) |
![]() | Domain d5vn4a1: 5vn4 A:1-235 [334699] Other proteins in same PDB: d5vn4a2 automated match to d1qb7a_ complexed with ade, hsx, mg, ppv |
PDB Entry: 5vn4 (more details), 1.35 Å
SCOPe Domain Sequences for d5vn4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vn4a1 c.61.1.0 (A:1-235) automated matches {Trypanosoma brucei [TaxId: 185431]} mslvevlpnyftlskdsplrkkfekvykwyspafsphdvprfaevgnitenpevmrgird ffvdryknlqqpithilgfdsrgfllgpmiavelnvpfvlirkankiagviiksepytke yaaeseecmtvrfgsfdknsrvvliddviatggtmlagvqlvdacgatlvevagilgltf lkgtqpahtfaggrysnvpfvtlvdetvlsdencgdplhhkgsriiscaeakkli
Timeline for d5vn4a1: