SCOPe 2.08: Domain d5vn4a1: 5vn4 A:1-235

Lineage for d5vn4a1 (5vn4 A:1-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:185431] [334698] (1 PDB entry)

8. Domain d5vn4a1: 5vn4 A:1-235 [334699]
   Other proteins in same PDB: d5vn4a2
   automated match to d1qb7a_
   complexed with ade, hsx, mg, ppv

Details for d5vn4a1

PDB Entry: 5vn4, 1.35 Å

PDB Description: crystal structure of adenine phosphoribosyl transferase from trypanosoma brucei in complex with amp, pyrophosphate, and ribose-5- phosphate

PDB Compounds: (A:) Adenine phosphoribosyltransferase, putative

SCOPe Domain Sequences for d5vn4a1:

Sequence; same for both SEQRES and ATOM records:

>d5vn4a1 c.61.1.0 (A:1-235) automated matches {Trypanosoma brucei [TaxId: 185431]}
mslvevlpnyftlskdsplrkkfekvykwyspafsphdvprfaevgnitenpevmrgird
ffvdryknlqqpithilgfdsrgfllgpmiavelnvpfvlirkankiagviiksepytke
yaaeseecmtvrfgsfdknsrvvliddviatggtmlagvqlvdacgatlvevagilgltf
lkgtqpahtfaggrysnvpfvtlvdetvlsdencgdplhhkgsriiscaeakkli

Timeline for d5vn4a1:

• d5vn4a1 first appeared in SCOPe 2.06
  
• d5vn4a1 appears in SCOPe 2.07