Lineage for d5tjfb_ (5tjf B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689299Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (2 PDB entries)
  8. 2689313Domain d5tjfb_: 5tjf B: [334696]
    automated match to d1kn1b_
    complexed with cl, cyc, na, peg

Details for d5tjfb_

PDB Entry: 5tjf (more details), 2.3 Å

PDB Description: the crystal structure of allophycocyanin from the red algae gracilaria chilensis
PDB Compounds: (B:) allophycocyanin beta subunit

SCOPe Domain Sequences for d5tjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tjfb_ a.1.1.3 (B:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mqdaitsvinaadvqgrylddnsldklrgyfqtgelrvrasatiaanaatiikdsvakal
lysditrpggnmyttrryaacirdldyylryatygmlagdpsildervlnglketynslg
vpigatiqavqamkevtsslvgpdagkemgvyfdyicsgls

SCOPe Domain Coordinates for d5tjfb_:

Click to download the PDB-style file with coordinates for d5tjfb_.
(The format of our PDB-style files is described here.)

Timeline for d5tjfb_: