Lineage for d5vg0a_ (5vg0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766336Species Jonesia denitrificans [TaxId:471856] [334644] (2 PDB entries)
  8. 2766337Domain d5vg0a_: 5vg0 A: [334679]
    automated match to d5aa7a_
    complexed with cu, per

Details for d5vg0a_

PDB Entry: 5vg0 (more details), 1.1 Å

PDB Description: room temperature x-ray crystallographic structure of a jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution.
PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d5vg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vg0a_ b.1.18.0 (A:) automated matches {Jonesia denitrificans [TaxId: 471856]}
hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
larwnvsntnnafyncmdvvvs

SCOPe Domain Coordinates for d5vg0a_:

Click to download the PDB-style file with coordinates for d5vg0a_.
(The format of our PDB-style files is described here.)

Timeline for d5vg0a_: