Lineage for d5uooa_ (5uoo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707636Domain d5uooa_: 5uoo A: [334678]
    automated match to d5c8ga_
    complexed with 8fv

Details for d5uooa_

PDB Entry: 5uoo (more details), 1.69 Å

PDB Description: brd4 bromodomain 2 in complex with cd161
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5uooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uooa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskl
eareyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpde

SCOPe Domain Coordinates for d5uooa_:

Click to download the PDB-style file with coordinates for d5uooa_.
(The format of our PDB-style files is described here.)

Timeline for d5uooa_: