SCOPe 2.08: Domain d5vh1a2: 5vh1 A:91-177

Lineage for d5vh1a2 (5vh1 A:91-177)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (9 species)
   duplication consists of two domains of this fold

7. Species Chicken (Gallus gallus) [TaxId:9031] [331435] (1 PDB entry)

8. Domain d5vh1a2: 5vh1 A:91-177 [334665]
   automated match to d1zwma2

Details for d5vh1a2

PDB Entry: 5vh1, 2.3 Å

PDB Description: crystal structure of chicken gamma s crystallin

PDB Compounds: (A:) Gamma S-crystallin

SCOPe Domain Sequences for d5vh1a2:

Sequence; same for both SEQRES and ATOM records:

>d5vh1a2 b.11.1.1 (A:91-177) gamma-Crystallin {Chicken (Gallus gallus) [TaxId: 9031]}
aqghiqvfekgdfggqmfeatedcpsileechfrevhacrvlegiwvfyehpnyrgrqyl
lpkgeyrqpvewgavtpavqsfrsiae

Timeline for d5vh1a2:

• d5vh1a2 first appeared in SCOPe 2.06
  
• d5vh1a2 appears in SCOPe 2.07