| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
| Protein gamma-Crystallin [49697] (9 species) duplication consists of two domains of this fold |
| Species Chicken (Gallus gallus) [TaxId:9031] [331435] (1 PDB entry) |
| Domain d5vh1a1: 5vh1 A:1-90 [334664] automated match to d1zwma1 |
PDB Entry: 5vh1 (more details), 2.3 Å
SCOPe Domain Sequences for d5vh1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vh1a1 b.11.1.1 (A:1-90) gamma-Crystallin {Chicken (Gallus gallus) [TaxId: 9031]}
sragpkvtfyedknflgrryecdadcpdfhtylnrcnsirveggtwvayerpnysgnmyv
lrrgeypdyhhwmglndrlgsckavhipsg
Timeline for d5vh1a1: