|  | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) | 
|  | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest | 
|  | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)  duplication contains two domains of this fold | 
|  | Family c.55.1.3: Hexokinase [53083] (3 proteins) | 
|  | Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes | 
|  | Species Human (Homo sapiens) [TaxId:9606] [53087] (6 PDB entries) | 
|  | Domain d1czan4: 1cza N:671-913 [33466] complexed with adp, g6p, glc; mutant | 
PDB Entry: 1cza (more details), 1.9 Å
SCOPe Domain Sequences for d1czan4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czan4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvd
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrt
Timeline for d1czan4: