Lineage for d5umna_ (5umn A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047655Domain d5umna_: 5umn A: [334658]
    Other proteins in same PDB: d5umnd1, d5umnd2, d5umnf1, d5umnf2
    automated match to d4fp8a_
    complexed with 1pe, flc, na, nag; mutant

Details for d5umna_

PDB Entry: 5umn (more details), 1.97 Å

PDB Description: crystal structure of c05 vpgsgw mutant bound to h3 influenza hemagglutinin, ha1 subunit
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5umna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5umna_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
pdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstyp
vlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
tpngsipndkpfqnvnkitygacpkyv

SCOPe Domain Coordinates for d5umna_:

Click to download the PDB-style file with coordinates for d5umna_.
(The format of our PDB-style files is described here.)

Timeline for d5umna_: