Lineage for d5u52e_ (5u52 E:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048069Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 3048070Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 3048071Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 3048072Protein Protein A Ig(Fc)-binding domain mimics [58866] (2 species)
  7. 3048073Species Staphylococcus aureus [TaxId:1280] [334652] (1 PDB entry)
  8. 3048074Domain d5u52e_: 5u52 E: [334653]
    automated match to d1l6xb_

Details for d5u52e_

PDB Entry: 5u52 (more details), 1.94 Å

PDB Description: 2 helix minimized version of the b-domain from protein a (z34c0 bound to igg1 fc (monoclinic form)
PDB Compounds: (E:) Mini Z domain

SCOPe Domain Sequences for d5u52e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u52e_ k.13.1.1 (E:) Protein A Ig(Fc)-binding domain mimics {Staphylococcus aureus [TaxId: 1280]}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOPe Domain Coordinates for d5u52e_:

Click to download the PDB-style file with coordinates for d5u52e_.
(The format of our PDB-style files is described here.)

Timeline for d5u52e_:

3048074
d5u52e_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5u52z_