SCOPe 2.08: Domain d5uvka_: 5uvk A:

Lineage for d5uvka_ (5uvk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (10 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [189582] (12 PDB entries)

8. Domain d5uvka_: 5uvk A: [334649]
   Other proteins in same PDB: d5uvkb_
   automated match to d1jboa_
   complexed with cyc

Details for d5uvka_

PDB Entry: 5uvk, 3.1 Å

PDB Description: serial millisecond crystallography of membrane and soluble protein micro-crystals using synchrotron radiation

PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d5uvka_:

Sequence; same for both SEQRES and ATOM records:

>d5uvka_ a.1.1.3 (A:) Phycocyanin alpha subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d5uvka_:

• d5uvka_ first appeared in SCOPe 2.06
  
• d5uvka_ appears in SCOPe 2.07