SCOPe 2.07: Domain d1bdga2: 1bdg A:223-460

Lineage for d1bdga2 (1bdg A:223-460)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Hexokinase [53084] (2 species)

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [53085] (1 PDB entry)

8. Domain d1bdga2: 1bdg A:223-460 [33462]
   complexed with glc, so4

Details for d1bdga2

PDB Entry: 1bdg, 2.6 Å

PDB Description: hexokinase from schistosoma mansoni complexed with glucose

PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d1bdga2:

Sequence; same for both SEQRES and ATOM records:

>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
kcavglivgtgtnvayiedsskvelmdgvkepevvintewgafgekgeldcwrtqfdksm
didslhpgkqlyekmvsgmylgelvrhiivylveqkilfrgdlperlkvrnslltryltd
verdpahllynthymltddlhvpvvepidnrivryacemvvkraaylagagiacilrrin
rsevtvgvdgslykfhpkfcermtdmvdklkpkntrfclrlsedgsgkgaaaiaasc

Timeline for d1bdga2:

• d1bdga2 first appeared (with stable ids) in SCOP 1.55, called d1bdg_2
  
• d1bdga2 appears in SCOPe 2.06
  
• d1bdga2 appears in the current release, SCOPe 2.08