Lineage for d1bdga2 (1bdg A:223-460)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857983Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 1857998Protein Hexokinase [53084] (2 species)
  7. 1858002Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [53085] (1 PDB entry)
  8. 1858004Domain d1bdga2: 1bdg A:223-460 [33462]
    complexed with glc, so4

Details for d1bdga2

PDB Entry: 1bdg (more details), 2.6 Å

PDB Description: hexokinase from schistosoma mansoni complexed with glucose
PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d1bdga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
kcavglivgtgtnvayiedsskvelmdgvkepevvintewgafgekgeldcwrtqfdksm
didslhpgkqlyekmvsgmylgelvrhiivylveqkilfrgdlperlkvrnslltryltd
verdpahllynthymltddlhvpvvepidnrivryacemvvkraaylagagiacilrrin
rsevtvgvdgslykfhpkfcermtdmvdklkpkntrfclrlsedgsgkgaaaiaasc

SCOPe Domain Coordinates for d1bdga2:

Click to download the PDB-style file with coordinates for d1bdga2.
(The format of our PDB-style files is described here.)

Timeline for d1bdga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bdga1