Lineage for d1bdg_2 (1bdg 223-460)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.3: Hexokinase [53083] (2 proteins) 
Protein Hexokinase [53084] (1 species) Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [53085] (1 PDB entry) 
Domain d1bdg_2: 1bdg 223-460 [33462]
Details for d1bdg_2
PDB Entry: 1bdg (more details), 2.6 Å
PDB Description: hexokinase from schistosoma mansoni complexed with glucose
SCOP Domain Sequences for d1bdg_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdg_2 c.55.1.3 (223-460) Hexokinase {Blood fluke (Schistosoma mansoni)}
kcavglivgtgtnvayiedsskvelmdgvkepevvintewgafgekgeldcwrtqfdksm
didslhpgkqlyekmvsgmylgelvrhiivylveqkilfrgdlperlkvrnslltryltd
verdpahllynthymltddlhvpvvepidnrivryacemvvkraaylagagiacilrrin
rsevtvgvdgslykfhpkfcermtdmvdklkpkntrfclrlsedgsgkgaaaiaasc
SCOP Domain Coordinates for d1bdg_2:
Click to download the PDB-style file with coordinates for d1bdg_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bdg_2:
- d1bdg_2 appears in SCOP 1.57
- d1bdg_2 appears in the current release, SCOPe 2.08, called d1bdga2
View in 3D
