Lineage for d5o00a2 (5o00 A:93-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713830Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)
  8. 2713848Domain d5o00a2: 5o00 A:93-229 [334600]
    Other proteins in same PDB: d5o00a1
    automated match to d4f0ca2
    complexed with gds, gol, nin, so4

Details for d5o00a2

PDB Entry: 5o00 (more details), 2.03 Å

PDB Description: ure2p5 from phanerochaete chrysosporium cocrystallized with 1-(s- glutathionyl)-2,4-dinitrobenzene.
PDB Compounds: (A:) Glutathione transferase Ure2p5

SCOPe Domain Sequences for d5o00a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o00a2 a.45.1.0 (A:93-229) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
vstfddkiimtqwlffqasgqgpyfgqagwflavappeernptiaeryqkeilrvfgvle
svlsqrqwlvadkltiadisfviwnatavnllvkgykgfdfekdfpsvhrwhtalitrpa
iaeslktkaeaiaqmnr

SCOPe Domain Coordinates for d5o00a2:

Click to download the PDB-style file with coordinates for d5o00a2.
(The format of our PDB-style files is described here.)

Timeline for d5o00a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o00a1