Lineage for d5mp4f_ (5mp4 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2856913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334502] (1 PDB entry)
  8. 2856919Domain d5mp4f_: 5mp4 F: [334596]
    automated match to d5f51a_
    complexed with po4

Details for d5mp4f_

PDB Entry: 5mp4 (more details), 2.79 Å

PDB Description: the structure of pst2p from saccharomyces cerevisiae
PDB Compounds: (F:) Protoplast secreted protein 2

SCOPe Domain Sequences for d5mp4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mp4f_ c.23.5.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
qvheiqgktfyetvakf

SCOPe Domain Coordinates for d5mp4f_:

Click to download the PDB-style file with coordinates for d5mp4f_.
(The format of our PDB-style files is described here.)

Timeline for d5mp4f_: