Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (31 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334502] (1 PDB entry) |
Domain d5mp4f_: 5mp4 F: [334596] automated match to d5f51a_ complexed with po4 |
PDB Entry: 5mp4 (more details), 2.79 Å
SCOPe Domain Sequences for d5mp4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mp4f_ c.23.5.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel qvheiqgktfyetvakf
Timeline for d5mp4f_: