![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (12 PDB entries) |
![]() | Domain d5mlub_: 5mlu B: [334587] automated match to d1s32f_ protein/DNA complex; complexed with mn |
PDB Entry: 5mlu (more details), 2.8 Å
SCOPe Domain Sequences for d5mlub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mlub_ a.22.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr ktvtamdvvyalkrqgrtlygfgg
Timeline for d5mlub_: