Lineage for d5tjfa_ (5tjf A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302507Protein automated matches [190531] (20 species)
    not a true protein
  7. 2302758Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (2 PDB entries)
  8. 2302771Domain d5tjfa_: 5tjf A: [334581]
    automated match to d1kn1a_
    complexed with cl, cyc, na, peg

Details for d5tjfa_

PDB Entry: 5tjf (more details), 2.3 Å

PDB Description: the crystal structure of allophycocyanin from the red algae gracilaria chilensis
PDB Compounds: (A:) allophycocyanin alpha subunit

SCOPe Domain Sequences for d5tjfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tjfa_ a.1.1.3 (A:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]}
siitksivnadaearylspgeldriksfvlsgqrrlriaqiltdnrelivkqggqqlfqk
rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvkemynslgt
pisgvaegvrsmknvacsllagedsaeagfyfdytlgamq

SCOPe Domain Coordinates for d5tjfa_:

Click to download the PDB-style file with coordinates for d5tjfa_.
(The format of our PDB-style files is described here.)

Timeline for d5tjfa_: