SCOPe 2.08: Domain d5tjfa_: 5tjf A:

Lineage for d5tjfa_ (5tjf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (23 species)
   not a true protein

7. Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (2 PDB entries)

8. Domain d5tjfa_: 5tjf A: [334581]
   automated match to d1kn1a_
   complexed with cl, cyc, na, peg

Details for d5tjfa_

PDB Entry: 5tjf, 2.3 Å

PDB Description: the crystal structure of allophycocyanin from the red algae gracilaria chilensis

PDB Compounds: (A:) allophycocyanin alpha subunit

SCOPe Domain Sequences for d5tjfa_:

Sequence; same for both SEQRES and ATOM records:

>d5tjfa_ a.1.1.3 (A:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]}
siitksivnadaearylspgeldriksfvlsgqrrlriaqiltdnrelivkqggqqlfqk
rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvkemynslgt
pisgvaegvrsmknvacsllagedsaeagfyfdytlgamq

Timeline for d5tjfa_:

• d5tjfa_ first appeared in SCOPe 2.06
  
• d5tjfa_ appears in SCOPe 2.07