Lineage for d5mota_ (5mot A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220398Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2220399Species Human (Homo sapiens) [TaxId:9606] [75559] (91 PDB entries)
  8. 2220490Domain d5mota_: 5mot A: [334579]
    automated match to d2pvra_
    complexed with act, hbd

Details for d5mota_

PDB Entry: 5mot (more details), 2.09 Å

PDB Description: crystal structure of ck2alpha with zt0627 bound
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5mota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mota_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvaaakikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvk

SCOPe Domain Coordinates for d5mota_:

Click to download the PDB-style file with coordinates for d5mota_.
(The format of our PDB-style files is described here.)

Timeline for d5mota_: