Lineage for d5tzna1 (5tzn A:91-215)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)
  8. 2560019Domain d5tzna1: 5tzn A:91-215 [334578]
    Other proteins in same PDB: d5tzna2
    automated match to d1yxja_
    complexed with bma, fuc, iod, nag

Details for d5tzna1

PDB Entry: 5tzn (more details), 2.6 Å

PDB Description: structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6)
PDB Compounds: (A:) Killer cell lectin-like receptor subfamily B member 1B allele B

SCOPe Domain Sequences for d5tzna1:

Sequence, based on SEQRES records: (download)

>d5tzna1 d.169.1.0 (A:91-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdnrwic
qkeln

Sequence, based on observed residues (ATOM records): (download)

>d5tzna1 d.169.1.0 (A:91-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsiekyns
fwiglsytltdmnwkwingtafnslkitgvtengscaaisgekvtsegcssdnrwicqke
ln

SCOPe Domain Coordinates for d5tzna1:

Click to download the PDB-style file with coordinates for d5tzna1.
(The format of our PDB-style files is described here.)

Timeline for d5tzna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tzna2
View in 3D
Domains from other chains:
(mouse over for more information)
d5tznw_