SCOPe 2.08: Domain d5tzna1: 5tzn A:91-215

Lineage for d5tzna1 (5tzn A:91-215)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)

8. Domain d5tzna1: 5tzn A:91-215 [334578]
   Other proteins in same PDB: d5tzna2
   automated match to d1yxja_
   complexed with iod

Details for d5tzna1

PDB Entry: 5tzn, 2.6 Å

PDB Description: structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6)

PDB Compounds: (A:) Killer cell lectin-like receptor subfamily B member 1B allele B

SCOPe Domain Sequences for d5tzna1:

Sequence, based on SEQRES records:

>d5tzna1 d.169.1.0 (A:91-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdnrwic
qkeln

Sequence, based on observed residues (ATOM records):

>d5tzna1 d.169.1.0 (A:91-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsiekyns
fwiglsytltdmnwkwingtafnslkitgvtengscaaisgekvtsegcssdnrwicqke
ln

Timeline for d5tzna1:

• d5tzna1 first appeared in SCOPe 2.06
  
• d5tzna1 appears in SCOPe 2.07