Lineage for d5jpga_ (5jpg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781220Species Norway rat (Rattus norvegicus) [TaxId:10116] [334399] (2 PDB entries)
  8. 2781221Domain d5jpga_: 5jpg A: [334561]
    automated match to d2d6pb_
    complexed with na

Details for d5jpga_

PDB Entry: 5jpg (more details), 1.9 Å

PDB Description: rat galectin 5 with lactose
PDB Compounds: (A:) Galectin-5

SCOPe Domain Sequences for d5jpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpga_ b.29.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssfstqtpypnlavpfftsipnglypsksivisgvvlsdakrfqinlrcggdiafhlnpr
fdenavvrntqinnswgpeerslpgsmpfsrgqrfsvwilceghcfkvavdgqhiceysh
rlmnlpdintlevagdiqlthvet

SCOPe Domain Coordinates for d5jpga_:

Click to download the PDB-style file with coordinates for d5jpga_.
(The format of our PDB-style files is described here.)

Timeline for d5jpga_: