Lineage for d1e4gt2 (1e4g T:200-392)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25009Family c.55.1.1: Actin/HSP70 [53068] (3 proteins)
  6. 25039Protein Cell division protein FtsA [53078] (1 species)
  7. 25040Species Thermotoga maritima [TaxId:243274] [53079] (2 PDB entries)
  8. 25044Domain d1e4gt2: 1e4g T:200-392 [33456]

Details for d1e4gt2

PDB Entry: 1e4g (more details), 2.6 Å

PDB Description: ftsa (atp-bound form) from thermotoga maritima

SCOP Domain Sequences for d1e4gt2:

Sequence, based on SEQRES records: (download)

>d1e4gt2 c.55.1.1 (T:200-392) Cell division protein FtsA {Thermotoga maritima}
ttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkhvikdvsavldtsfeeserl
iithgnavyndlkeeeiqyrgldgntiktttakklsviiharlreimskskkffreveak
iveegeigipggvvltgggakiprinelatevfkspvrtgcyansdrpsiinadevandp
sfaaafgnvfavs

Sequence, based on observed residues (ATOM records): (download)

>d1e4gt2 c.55.1.1 (T:200-392) Cell division protein FtsA {Thermotoga maritima}
ttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkhvikdvsavldtsfeeserl
iithgnavyndlkeeeiqyrgldgntiktttakklsviiharlreimskskkffreveak
gipggvvltgggakiprinelatevfkspvrtgcyansdrpsiinadevandpsfaaafg
nvfavs

SCOP Domain Coordinates for d1e4gt2:

Click to download the PDB-style file with coordinates for d1e4gt2.
(The format of our PDB-style files is described here.)

Timeline for d1e4gt2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4gt1