Lineage for d5g5rb1 (5g5r B:1-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744022Domain d5g5rb1: 5g5r B:1-116 [334556]
    Other proteins in same PDB: d5g5rb2
    automated match to d4zg1a_
    complexed with so4

Details for d5g5rb1

PDB Entry: 5g5r (more details), 2.4 Å

PDB Description: cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - apo form
PDB Compounds: (B:) Nanobody

SCOPe Domain Sequences for d5g5rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5rb1 b.1.1.1 (B:1-116) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgsgfnnnamgwyrqapgkqrelvaaitsfgstnya
dsvkgrftisrdnakntvylqmnslkpedtavyyctagwgatprsywgqgtqvtvs

SCOPe Domain Coordinates for d5g5rb1:

Click to download the PDB-style file with coordinates for d5g5rb1.
(The format of our PDB-style files is described here.)

Timeline for d5g5rb1: