SCOPe 2.06: Domain d1e4gt1: 1e4g T:6-199

Lineage for d1e4gt1 (1e4g T:6-199)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Cell division protein FtsA [53078] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [53079] (3 PDB entries)

8. Domain d1e4gt1: 1e4g T:6-199 [33455]
   complexed with atp, mg

Details for d1e4gt1

PDB Entry: 1e4g, 2.6 Å

PDB Description: ftsa (atp-bound form) from thermotoga maritima

PDB Compounds: (T:) cell division protein ftsa

SCOPe Domain Sequences for d1e4gt1:

Sequence; same for both SEQRES and ATOM records:

>d1e4gt1 c.55.1.1 (T:6-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
ktvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllk
eleeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklken
gktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspf
qlksslvstaegvl

Timeline for d1e4gt1:

• d1e4gt1 first appeared (with stable ids) in SCOP 1.55
  
• d1e4gt1 appears in SCOPe 2.05
  
• d1e4gt1 appears in SCOPe 2.07
  
• d1e4gt1 appears in the current release, SCOPe 2.08