| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Cell division protein FtsA [53078] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [53079] (2 PDB entries) |
| Domain d1e4gt1: 1e4g T:6-199 [33455] |
PDB Entry: 1e4g (more details), 2.6 Å
SCOP Domain Sequences for d1e4gt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4gt1 c.55.1.1 (T:6-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
ktvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllk
eleeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklken
gktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspf
qlksslvstaegvl
Timeline for d1e4gt1: