Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [334399] (2 PDB entries) |
Domain d5jpgb_: 5jpg B: [334545] automated match to d2d6pb_ complexed with lbt, na |
PDB Entry: 5jpg (more details), 1.9 Å
SCOPe Domain Sequences for d5jpgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jpgb_ b.29.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} pnlavpfftsipnglypsksivisgvvlsdakrfqinlrcggdiafhlnprfdenavvrn tqinnswgpeerslpgsmpfsrgqrfsvwilceghcfkvavdgqhiceyshrlmnlpdin tlevagdiqlthvet
Timeline for d5jpgb_: