SCOPe 2.08: Domain d5jpgb_: 5jpg B:

Lineage for d5jpgb_ (5jpg B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [334399] (2 PDB entries)

8. Domain d5jpgb_: 5jpg B: [334545]
   automated match to d2d6pb_
   complexed with na

Details for d5jpgb_

PDB Entry: 5jpg, 1.9 Å

PDB Description: rat galectin 5 with lactose

PDB Compounds: (B:) Galectin-5

SCOPe Domain Sequences for d5jpgb_:

Sequence; same for both SEQRES and ATOM records:

>d5jpgb_ b.29.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pnlavpfftsipnglypsksivisgvvlsdakrfqinlrcggdiafhlnprfdenavvrn
tqinnswgpeerslpgsmpfsrgqrfsvwilceghcfkvavdgqhiceyshrlmnlpdin
tlevagdiqlthvet

Timeline for d5jpgb_:

• d5jpgb_ first appeared in SCOPe 2.06
  
• d5jpgb_ appears in SCOPe 2.07