Lineage for d5g5kb_ (5g5k B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833008Species Pseudomonas aeruginosa [TaxId:208964] [332878] (7 PDB entries)
  8. 2833022Domain d5g5kb_: 5g5k B: [334544]
    Other proteins in same PDB: d5g5ka2
    automated match to d3gs6a_
    complexed with nok

Details for d5g5kb_

PDB Entry: 5g5k (more details), 3.1 Å

PDB Description: crystal structure of nagz from pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin
PDB Compounds: (B:) Beta-hexosaminidase

SCOPe Domain Sequences for d5g5kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5kb_ c.1.8.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdllla
vdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvldl
dhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaiped
arsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdgv
ifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrlq
rmrgkgyantdyrqqprwlealsalraaqlid

SCOPe Domain Coordinates for d5g5kb_:

Click to download the PDB-style file with coordinates for d5g5kb_.
(The format of our PDB-style files is described here.)

Timeline for d5g5kb_: