Lineage for d5g3rb1 (5g3r B:1-332)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419345Species Pseudomonas aeruginosa [TaxId:208964] [332878] (7 PDB entries)
  8. 2419351Domain d5g3rb1: 5g3r B:1-332 [334537]
    Other proteins in same PDB: d5g3ra2, d5g3rb2
    automated match to d3gs6a_
    complexed with 89a, nag, peg

Details for d5g3rb1

PDB Entry: 5g3r (more details), 2.18 Å

PDB Description: crystal structure of nagz from pseudomonas aeruginosa in complex with n-acetylglucosamine and l-ala-1,6-anhydromurnac

SCOPe Domain Sequences for d5g3rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g3rb1 c.1.8.0 (B:1-332) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdllla
vdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvldl
dhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaiped
arsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdgv
ifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrlq
rmrgkgyantdyrqqprwlealsalraaqlid

SCOPe Domain Coordinates for d5g3rb1:

Click to download the PDB-style file with coordinates for d5g3rb1.
(The format of our PDB-style files is described here.)

Timeline for d5g3rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g3rb2